PeptidePlaza
The Free Peptide Reference

Thymosin

From PeptidePlaza, the free peptide reference · Entry #1004 · Anti-Aging · Sources fetched 2026-09-10 · Editorial standards

Thymosin (also known as Thymosins, Recombinant Thymosin) is a anti-aging research peptide. Thymosin is an endogenous human peptide that plays a role in cytoskeleton organization by binding to and sequestering actin monomers, thereby inhibiting actin polymerization.

Thymosin, also known as Thymosins, is an endogenous human peptide involved in the organization of the cytoskeleton. Its mechanism of action involves binding to and sequestering actin monomers (G actin), which in turn inhibits actin polymerization. This peptide is currently in Phase 3 clinical trials and has been investigated for various conditions, including Pressure Ulcer, ST Elevation Myocardial Infarction, Epidermolysis Bullosa, Dry Eye Syndromes, Varicose Ulcer, Severe Acute Respiratory Syndrome, Myocardial Infarction, and Thymus Neoplasms. Research on thymosin has explored its basic properties, clinical applications, and its role in conditions such as kidney disease and immune reconstitution in HIV-infected patients.

1 Mechanism of action

Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity)

2 Reported effects

Effects below are those reported in the published literature cited on this page. They are not claims of clinical benefit and not medical advice.

2.1 Indicated / studied for

  • Pressure Ulcer
  • ST Elevation Myocardial Infarction
  • Epidermolysis Bullosa
  • Dry Eye Syndromes
  • Varicose Ulcer
  • Severe Acute Respiratory Syndrome
  • Myocardial Infarction
  • Thymus Neoplasms

3 Chemical and physical properties

CAS number61512-21-8
Molar mass3051.3 g/mol
Purity (typical)Not independently verified
Storage−20 °C, lyophilised powder, desiccated
SolubilitySterile water / bacteriostatic water

3.1 Amino acid sequence

MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

4 Research studies (8)

  1. beta-Thymosins
    Annals of the New York Academy of Sciences (2007) · Review
  2. Thymosin β4: a multi-functional regenerative peptide. Basic properties and clinical applications
    Expert opinion on biological therapy (2012)
  3. Structures of Thymosin Proteins
    Vitamins and hormones (2016) · Review
  4. A pilot study of the safety and efficacy of thymosin alpha 1 in augmenting immune reconstitution in HIV-infected patients with low CD4 counts taking highly active antiretroviral therapy
    Clinical and experimental immunology (2003) · RCT
  5. The role of thymosin-β4 in kidney disease
    Expert opinion on biological therapy (2015)
  6. Thymosin-β4: A key modifier of renal disease
    Expert opinion on biological therapy (2018) · Review
  7. Activation of tumor-associated macrophages by thymosin alpha 1
    International journal of immunopathology and pharmacology (2004)
  8. Reconstitution of T cell functions in aging mice by thymosin alpha 1
    Immunopharmacology (1986)

5 Safety and risk profile

5.1 Regulatory status

Thymosin is currently classified as Phase 3 clinical trials. It has no approved human indication in the United States; availability elsewhere does not imply demonstrated safety or efficacy.

Safety data disclaimer. Safety assessments are based on published literature and are for educational reference only. Clinical evidence varies significantly between peptides. Always consult primary research and current regulatory guidance.

6 Frequently asked questions

What is Thymosin?
Thymosin is an endogenous human peptide that is also known as Thymosins or Recombinant Thymosin. It is composed of 44 amino acid residues and is involved in various cellular processes, particularly related to the cytoskeleton.
How does Thymosin work?
Thymosin functions by binding to and sequestering actin monomers, specifically G-actin. This action inhibits the polymerization of actin, which is crucial for the organization and dynamics of the cell's cytoskeleton.
What is Thymosin studied for?
Thymosin is being studied for a range of conditions, including Pressure Ulcer, ST Elevation Myocardial Infarction, Epidermolysis Bullosa, Dry Eye Syndromes, Varicose Ulcer, Severe Acute Respiratory Syndrome, Myocardial Infarction, and Thymus Neoplasms. It has reached Phase 2 clinical trials for these indications.
What is the regulatory status of Thymosin?
Thymosin is currently in Phase 3 of clinical development. This indicates that it is undergoing large-scale testing to confirm its efficacy, monitor side effects, compare it to commonly used treatments, and collect information that will allow it to be used safely.

7 References

  1. Thymosin — compound summary PubChem. View source
  2. Thymosin — molecule record ChEMBL. View source
  3. Thymosin — protein entry UniProt. View source
  4. Thymosin — published literature (2,895 records) PubMed. View source

Related compounds

Entries that share a target, a mechanism, or a research area with Thymosin.

Bradykininrecovery

Shares plays and important pharmacology

Bradykinin is an endogenous human peptide involved in various physiological processes, including blood coagulation and inflammation.

Humaninanti-aging

Also anti-aging

A 21-amino acid mitochondria-encoded peptide discovered through its ability to rescue neurons from Alzheimer's-related death. Like MOTS-c, it belongs to the emerging class of mitochondrial-derived peptides with systemic metabolic and cytoprotective effects.

Glutathioneanti-aging

Also anti-aging

The body's master antioxidant and the most abundant intracellular thiol. An unusual gamma peptide bond makes it resistant to normal peptidases — and its depletion tracks almost every disease of ageing.

8 See also

For research reference only. Not medical advice. Peptides may be regulated or restricted in your jurisdiction. Entry validated by the PeptidePlaza Biomedical Research Desk; see editorial standards.