Parathyroid Hormone
From PeptidePlaza, the free peptide reference · Entry #1161 · Metabolic · Sources fetched 2026-09-11 · Editorial standards
Parathyroid Hormone is a metabolic research peptide. Parathyroid Hormone is an 84-residue peptide that acts as a parathyroid hormone receptor agonist. It is FDA approved and marketed as Bestmade Natural Products BM67.
Parathyroid Hormone is a peptide consisting of 84 amino acid residues, functioning as an agonist for the parathyroid hormone receptor. It has been extensively studied, with over 38,000 papers in PubMed, and is FDA approved. The compound is indicated for conditions such as hypocalcemia, postmenopausal osteoporosis, and hypoparathyroidism, and has also been investigated for osteoporosis, psoriasis, and hyperparathyroidism. Research on Parathyroid Hormone frequently explores its physiological roles and its involvement in the pathophysiology of hypercalcemia.
1 Mechanism of action
Parathyroid hormone receptor agonist (agonist)
Primary targets: Parathyroid hormone receptor
2 Reported effects
Effects below are those reported in the published literature cited on this page. They are not claims of clinical benefit and not medical advice.
2.1 Indicated / studied for
- Hypocalcemia
- Osteoporosis, Postmenopausal
- Hypoparathyroidism
- Osteoporosis
- Psoriasis
- Hyperparathyroidism
3 Chemical and physical properties
| Purity (typical) | Not independently verified |
|---|---|
| Brand names | Bestmade Natural Products BM67 |
| Route | ORAL |
| Storage | −20 °C, lyophilised powder, desiccated |
| Solubility | Sterile water / bacteriostatic water |
| Receptors / targets | Parathyroid hormone receptor |
3.1 Amino acid sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
4 Research dosages
Ages 12 or older, 10 drops. Ages 12-2, 5 drops. Ages 2 and under, consult your Doctor. Mix with half a cup of water 3-4 times per day.
5 Research studies (8)
- Parathyroid Hormone
(2006) · Review - Parathyroid hormone
The Journal of the American Academy of Orthopaedic Surgeons (2004) · Review - Parathyroid hormone-like peptide
Endocrine pathology (1991) · Review - Pathophysiology of Hypercalcemia
Endocrinology and metabolism clinics of North America (2021) · Review - Physiology of Parathyroid Hormone
Endocrinology and metabolism clinics of North America (2018) · Review - Endosomal parathyroid hormone receptor signaling
American journal of physiology. Cell physiology (2022) · Review - [Parathyroid hormone (PTH)]
Nihon rinsho. Japanese journal of clinical medicine (2005) · Review - Parathyroid hormone receptor
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association (1994) · Review
6 Safety and risk profile
6.1 Regulatory status
Parathyroid Hormone is currently classified as FDA approved. Approval applies to specific clinical indications and dosing; research-grade material is not the approved product.
6.2 Long-term risks
- severe symptoms
- reaction to this product that is not positive
6.3 Research best practices
- Store in a cool and dry place
- Keep away from children
7 Frequently asked questions
- What is Parathyroid Hormone?
- Parathyroid Hormone is an 84-residue peptide that functions as an agonist for the parathyroid hormone receptor. It is a well-documented compound with extensive research in the scientific literature.
- How does Parathyroid Hormone work?
- Parathyroid Hormone works by acting as an agonist for the parathyroid hormone receptor. This mechanism allows it to influence physiological processes related to calcium regulation and bone metabolism.
- What is Parathyroid Hormone used for?
- Parathyroid Hormone is indicated for conditions such as hypocalcemia, postmenopausal osteoporosis, and hypoparathyroidism. It has also been studied for its potential use in osteoporosis, psoriasis, and hyperparathyroidism.
- Is Parathyroid Hormone FDA approved?
- Yes, Parathyroid Hormone is FDA approved. It is marketed under the name Bestmade Natural Products BM67 and is administered orally.
8 References
- Parathyroid Hormone — molecule record ChEMBL. View source
- Parathyroid Hormone — protein entry UniProt. View source
- Parathyroid Hormone — FDA approved prescribing information U.S. Food and Drug Administration. View source
- Parathyroid Hormone — published literature (38,677 records) PubMed. View source
Related compounds
Entries that share a target, a mechanism, or a research area with Parathyroid Hormone.
Also metabolic
Gastrin is an endogenous human peptide that stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete digestive enzymes.
Also metabolic
Ghrelin is a peptide hormone that acts as a ligand for the growth hormone secretagogue receptor (GHSR). It is involved in regulating appetite, metabolism, and growth hormone release.
Also metabolic
Seractide Acetate is a synthetic peptide that acts as a melanocortin receptor 2 agonist.
Also metabolic
Octreotide is a somatostatin analog indicated for reducing growth hormone and IGF-1 levels in acromegaly, and for managing severe diarrhea and flushing associated with metastatic carcinoid tumors and VIPomas.
Also metabolic
The GLP-1 that proved the class. A C16 palmitoyl chain gave native GLP-1 a 13-hour half-life instead of two minutes — and produced the first cardiovascular outcome data for the family.
Also metabolic
A long-acting GLP-1 analog distinguished by its C18 fatty diacid chain, enabling albumin binding and a half-life of ~7 days. One of the most clinically studied peptides in modern metabolic research.