Human Neuropeptide Y

Human Neuropeptide Y (also known as Neuropeptide Y (human,rat), YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) is a nootropic research peptide. Human Neuropeptide Y is an investigational peptide that acts as a ligand for neuropeptide Y receptors.

Human Neuropeptide Y is a peptide under investigation for its role in biological systems. It functions as a ligand for neuropeptide Y receptors, influencing various physiological processes. Research has explored its structural characteristics, including its crystal and solution structures, and its interaction with specific receptor subtypes. Studies have also investigated the C-terminal motif of the human neuropeptide Y4 receptor in relation to internalization and arrestin recruitment, as well as the inhibition of neuropeptide Y-evoked vasoconstriction by antisense oligodeoxynucleotides targeting the Y1 receptor.

1 Chemical and physical properties

2 Research studies (8)

1. N-(4-[(18)F]Fluoro-benzoyl)-N'-{2-[5-(4-fluoro-benzyl)-1-(4-methoxy-benzyl)-4,6-dioxo-1,4,5,6-tetrahydro-[1,3,5]triazin-2-ylamino]-ethyl}-guanidine
   (2004) · Review
2. Crystal structures of human neuropeptide Y (NPY) and peptide YY (PYY)
   Neuropeptides (2022)
3. Solution structure of human neuropeptide Y
   Journal of biomolecular NMR (1996)
4. Human neuropeptide Y Y1 receptor antisense oligodeoxynucleotide specifically inhibits neuropeptide Y-evoked vasoconstriction
   European journal of pharmacology (1993)
5. C-terminal motif of human neuropeptide Y(4) receptor determines internalization and arrestin recruitment
   Cellular signalling (2017)
6. Cell-Free Expression and Photo-Crosslinking of the Human Neuropeptide Y(2) Receptor
   Frontiers in pharmacology (2019)
7. Micellar nanomedicine of human neuropeptide Y
   Nanomedicine : nanotechnology, biology, and medicine (2011)
8. Expression of the human neuropeptide Y gene
   The Journal of biological chemistry (1990)

3 Safety and risk profile

3.1 Regulatory status

Human Neuropeptide Y is currently classified as Investigational. It has no approved human indication in the United States; availability elsewhere does not imply demonstrated safety or efficacy.

4 Frequently asked questions

What is Human Neuropeptide Y?

Human Neuropeptide Y is an investigational peptide that serves as a ligand for neuropeptide Y receptors. It is being studied for its biological functions and interactions within the body.

How does Human Neuropeptide Y work?

Human Neuropeptide Y works by binding to neuropeptide Y receptors. This interaction can influence various cellular processes, including vasoconstriction and receptor internalization, depending on the specific receptor subtype involved.

What is the regulatory status of Human Neuropeptide Y?

Human Neuropeptide Y is currently in an investigational stage. This means it is undergoing research and development to understand its properties and potential applications.

What has been studied about Human Neuropeptide Y?

Studies on Human Neuropeptide Y have focused on its crystal and solution structures, its interaction with neuropeptide Y receptor subtypes, and the mechanisms of receptor internalization and arrestin recruitment. Research also includes investigations into its effects on vasoconstriction.

5 References

1. Human Neuropeptide Y — compound summary PubChem. View source
2. Human Neuropeptide Y — molecule record ChEMBL. View source
3. Human Neuropeptide Y — published literature (148 records) PubMed. View source

6 See also

• Peptide encyclopedia index
• Peptide reconstitution calculator
• Glossary of peptide research terms